China Other Business Travel Services Fournisseur, Fabricant, Usine, Exportateur Other Business Travel Services From Global Suppliers and Manufacturers

Products Buy Offers Offres de vente Centre d'apprentissage Offres d'achat Connexion S'inscrire gratuitement Aide

produits présentés

Sort By: Points de confiance

Filter By: Brochure

(378 Produits) Page 4 de 16

Hello, I m Mr. Ciss mansou nome responsible of a cooperative of miners in Burkina Faso, we currently have a large amount of gold powder gross of *2 + carat precisely **0kgs of gold and ...

Membre gratuit

ErafBurkina

Points de confiance : 0

Contacter maintenant

Diamond 500 Carat

We are offering diamond thank you for reading this email. We are a factory specializes in the production and export of mineral, we have our own smelting furnace, and we also have long-term cooperat...

Membre gratuit

Jenka Diamond SARL

Points de confiance : 0

Contacter maintenant

Cheap Airport Taxi Services

We provide a *4/7 cheap reliable airport taxi service transfers and minibus hiring across the London UK. We offer affordable price to hire coach or minibus from a wide range of current models vehic...

Membre gratuit

Low Fare Airport Cars

Points de confiance : 0

Contacter maintenant

Brouilleur De Tlphone Cellulaire De Haute Puissance

Je ne pouvais mme pas pens que j utiliserais un dispositif de brouillage de signal, mais j ai achet ce copain. Je dois communiquer avec les gens toute la semaine tant...

Membre gratuit

Gros-shop

Points de confiance : 0

Contacter maintenant

-Amyloid 1-42 , Rat

-Amyloid ***2 , rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA ASP ALA GLU PHE GLY HIS ASP SER GLY PHE GLU VAL ARG HIS GLN LYS LEU VAL PHE PHE ALA GLU ASP VAL GLY ...

Membre gratuit

Chinapeptides co.ltd

Points de confiance : 0

Contacter maintenant

Country Derby On Blackthorn Shaft

A smart, rustic stick of great character. The derby handle offers excellent support to the hand, and may be hooked over the arm when not in use. A smart brass collar joins it to a natural blackthor...

Membre gratuit

Walkingcanes

Points de confiance : 0

Contacter maintenant

Uber Coupons - Flat Rs.100 Off On First 2 Rides

Offer*1 Flat Rs.**0 OFF on First 2 Rides Apply Coupon Code ICICI**0 Offer*2 Flat Rs *5 Off On First 2 Rides Apply Coupon Code- UBERPCC*0 Hide Uber coupons Deals. The Maximum relevant d...

Membre gratuit

Mytokri.com

Points de confiance : 0

Contacter maintenant

Uber Coupons Paytm Offer - FLAT Rs.75 OFF On Rides 2 Rides/User

Offer*1 FLAT Rs.*5 OFF On Rides 2 Rides/User Apply Coupon Code PAYTM**0 Offer *2 Get 2 Free Rides Of Upto Rs *5/- Via Paytm Wallet Code- DEAL**0

Membre gratuit

Mytokri.com

Points de confiance : 0

Contacter maintenant

POTOKINVESTGROUP GROUP

Am a Seller Mandate, we can suply D2, Mazut, Jp*4, Russai D2 Gas oil, Bitumen, Urea We have this quality product for a good buyers D2.Diesel Oil Attention, LLC POTOKINVEST GROUP is a regis...

Membre gratuit

POTOKINVESTGROUP GROUP

Points de confiance : 0

Contacter maintenant

Sale Damascus Knifes

I am Jones And I Make Damascus, steel.knifes, kukries Swoad, Axe etc Buy this knifes If you intrest me please Contact me **********3 **********7

Membre gratuit

Goher Nayab Damascus Steel knifes Maker

Points de confiance : 0

Contacter maintenant

Sourcing Agent, Inspection, Logistics Organizer In Foshan China

My name is Wilson. I am a sourcing agent in Foshan city, Guangdong, China. I Specialize insourcing various products, like 1. Building material, such as tile, wash basin, steam room, shower room, wo...

Membre gratuit

Wilson

Points de confiance : 0

Contacter maintenant

Mumbai Pune Taxi Services Best Cool Cab Airport Drop Rental Fare

Cool Cab Services has been providing cabs on the Mumbai Pune Taxi Services Route since 8 years. We have been known and have been recognized for our efforts. We have a team which provides great cust...

Membre gratuit

Cool Cabs

Points de confiance : 0

Contacter maintenant

Rental Car Service

KHAIANHGROUP that our company provides about rental cars long term and short term service, which the quality is toward high standard product to make our hardest customer who ...

Membre gratuit

Khai Anh construction architecture corporation

Points de confiance : 0

Contacter maintenant

Freight Forwarders

Dear Sirs we are pleased to contact you we are Freight Link Egypt offering you best freight rates from/ TO Egy......

Membre gratuit

Freight Link

Points de confiance : 0

Contacter maintenant

Freight Forwarders

Dear Sirs we are pleased to contact you we are Freight Link Egypt offering you best freight rates from/ TO......

Membre gratuit

Freight Link

Points de confiance : 0

Contacter maintenant

Adelaide Charter

Established nearly *0 years ago, Hartwig Air is the leading centre for Adelaide Charter Services in South Australia. Founded on a long and proud tradition of excellence in air charter services and ...

Membre gratuit

Hartwig123

Points de confiance : 0

Contacter maintenant

Presidential Aviation - Private Jet Charter, Management And Maintenance

Presidential Aviation is an industry-leading boutique Aircraft Management, Aircraft Maintenance and Private Jet Charter company dedicated to providing the highest quality of personalized service to...

Membre gratuit

Presidential Aviation

Points de confiance : 0

Contacter maintenant

Hexagonal Wood Screws

Hex head widths width across flats, wrench size for DIN **4 hex nuts and hex head bolts. Other usually smaller sizes may occur for reasons of weight or cost reduction.

Membre gratuit

Haiyan Tianqi Fastener Co., Ltd.

Points de confiance : 0

Contacter maintenant

Dreamtrip Worldtravel

This is a worldwide opportunity for you to travel with less worry on budget and enjoy the lifestyle and also making money while on these trips...follow me on Dreamtrips by contact me on my email......

Membre gratuit

Jadell02 and Associates Limited

Points de confiance : 0

Contacter maintenant

AEC Resources MICE+Business Travel

Our MICE business is the organizer and consultants, not a broker. Our services are covered all tasks from the beginning until the end of function like planning, budgeting, registration, logistics, ...

Membre gratuit

AEC Resources (Thailand) Co., Ltd.

Points de confiance : 0

Contacter maintenant

Assistant Oversea By Collaborative Resources

Assistant Oversea Assistant oversea is an efficient service for buyer. When you travel oversea, you may need local specialist to help you making schedule, traffic, arranging meeting etc. You may s...

Membre gratuit

AirIbs

Points de confiance : 0

Contacter maintenant

Thailand Tourist Visa Processing , Business Visa Processing

**0 **0 **0 ...

Membre gratuit

SHANGHAI HANGPENG VISA CENTER

Points de confiance : 0

Contacter maintenant

Domain Name For Sale

Babamaket Dot Com Promote your Website Globally best chance to Avail this Domian 1 year domian Hosting also Available Best B2B Domian for sale. best B2B Domian for sale starting pric...

Membre gratuit

Bechdo.pk

Points de confiance : 0

Contacter maintenant

Clothing Exports To The United States LDP Customs Clearance To The Doo

LDP landed duty paid delivered duty paid price, is actually and DDP terms as, the seller needs to responsible for all cargo transportation and insurance, customs clearance, tax, delivery, and alw...

Membre gratuit

Sheena City Star Lin International Freight Forwarders Co. Ltd. Qing...

Points de confiance : 0

Contacter maintenant

Audio Guide Player For Museums And Tour In Exhibitions

Wireless Portable Audio Guide/ Audio Tour Guide System AT***0/ATC***0/ATC***0U - Built-in 1G or up to 2G memory card for high quality of mp3 digital audio compression. - ...

Membre gratuit

OKAYO Electronics Co., Ltd.

Points de confiance : 0

Contacter maintenant

< Préc. 1 2 3 4 5 6 7 8 Suiv. >

Toutes les citations / Produits / Profils des sociÃ©tÃ©s / images et autres contenus sont postÃ©s par l'utilisateur, Tradekey ne peut en Ãªtre tenu pour responsable. Cependant, Tradekey respecte la propriÃ©tÃ© intellectuelle, le droit d'auteur, la marque commerciale, les secrets commerciaux ou tout autre droit de propriÃ©tÃ© personnel ou exclusif appartenant Ã un tiers, nous nous attendons Ã ce que les autres puissent le faire. Si vous avez des questions, veuillez nous contacter. Created in 7.26573 seconds

❯

I'm a Buyer I'm a Supplier

By Signing Up. I agree to TradeKey.com Terms of Use, Privacy Policy, IPR and receive emails related to our services

❯

BOOK A CALL

Book Call On Your Favorite Time

I'm a Buyer I'm a Supplier

By Signing Up. I agree to TradeKey.com Terms of Use, Privacy Policy, IPR and receive emails related to our services

produits présentés

Get Verified Buyers & Suppliers

Avail Free Consultation