Prix FOB
Obtenir le dernier prix|
5 Milligram Minimum Order
Pays:
China
N ° de modèle:
-
Prix FOB:
Localité:
-
Prix de commande minimale:
-
Commande minimale:
5 Milligram
Packaging Detail:
1mg/tube
Heure de livraison:
1 week
Capacité de Fournir:
-
Payment Type:
T/T, Western Union, PayPal
Groupe de produits :
-
China
Personne àcontacter Annie
Shanghai, Shanghai
A (***0) together with A (***2) are two major C-terminal variants of the A protein constituting the majority of As. These undergo post-secretory aggregation and deposition in the Alzheimers disease brain.
| Storage |
**0°C  |
|
Sequence (One-Letter Code) |
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Molecular Weight | ***9.9 |
| Pays: | China |
| N ° de modèle: | - |
| Prix FOB: | Obtenir le dernier prix |
| Localité: | - |
| Prix de commande minimale: | - |
| Commande minimale: | 5 Milligram |
| Packaging Detail: | 1mg/tube |
| Heure de livraison: | 1 week |
| Capacité de Fournir: | - |
| Payment Type: | T/T, Western Union, PayPal |
| Groupe de produits : | - |
